Quick & Easy Mole Cauliflower Enchiladas with Roasted Garlic Cashew Cream (Vegan, Gluten Free) | Sprouted Routes

Will be serving stuff like this at my future retreat centre.

Other news: am seeing a dietitian for help tomorrow that I’ve not been receptive to for years. It’s going to suck. But she’s someone I can trust, being an athlete and understanding of Eating Disorders. Despite being a Nutritionist myself, I’m realizing that I really could benefit from having some perspective and expertise with my diet; disbitchhas habits n irrational eating patterns that keep me small and dis-eased. Ego aside, I wave the white flag #racism 🙃

I saw Jennifer back in uni years ago when I went to UWO. #ifwineisntlegalinmealplanigiveup 

This time, I’m choosing to let go of some control. I’m reading lots about the first step (of many) is to mechanically refeed so I can think rationally. Right now I can see areas of irrationality. Ya this is not going to be easy and I’m gritting my teeth but must surrender.

West Coast in 10 lbs? (And $5000 or something…)

Peanut Protein Sauce

I found a peanut protein powder (from Homesense) without 💩in it, so homade sauce for when working outside lunch not needing refrigeration.


Peanut Protein Sauce:

2 TBSP peanut Protein pow 

1-2 Tbsp sesame seeds

1 tbsp flaxseeds

Sriracha, soya, chicken stock (could use Pure Bone broth if you’re on the Best coast…or water, or almond/coconut milk)

Directions:

Dry toast seeds in pan. (I also toasted cumin seeds w it). Add PB pow, liquid. Mix. Yum.

I topped a salad w this and sesame oil dressing and peanuts.

Rajasic Restless Rest

Energy release via creative outlet in passing my rest day: culinary blending of le shits

Beef jerky, coconut chips, sundried tomato

Salad topper #veganjustkidding


Beretta farms beef jerky and toasted coconut yum.

Rest is hard but good #thatswhatshesaid

Coco Cauli Salad

Shared with good people, and saved for myself.

Coconut Cauliflower Salad:

FullSizeRender (5)

Salad Ingredients:

1 head cauliflower, chopped
1/4 red onion, chopped small
1 carrot, grated (dontpeelthatshitjustscrubit)

Dressing:

#homade coconut milk: 1/3 cup coco shreds, 1/2 cup boiling water (let it sit for some minutes) then high speed blend
1 tbsp miso paste
black pepper
lemon juice
sriracha

Mis together.

Top with: toasted coconut flakes

#hireme

Avocado Gazpacho

I’m starting to be able to feel hunger and cravings, which is new because I’ve totally blocked off those signals.

Like, I’m craving fat….yesterday I licked clean the chicken leg I was eating, skin and all (hormone-free etcetcetc).

Here’s yum:

Screen shot 2017-06-28 at 7.38.26 AM

Blend together these ingredients:
2 small garden cukes (unpeeled is fine if thin skin and fresh)
1/4 big avocado, or 1/2 small
Squeeze of lime juice
Some good squirts fish sauce
1 cup Almond milk (or milk of choice)
1 cup veg stock (or water/chicken stock)
2 green olives
1 tbsp nutritional yeast
Black pepper
Small hunk of red onion
Handful cilantro
Top with: egg, nori, konjac noodles, unhulled hemp hearts, sesame seeds
Other options: shrimp, nuts, croutons, roasted chickpeas, sprouts, drizzle olive oil or coconut milk
Serves 1

Beet Blueberry Superfood Smoothie Bowl

beet hemp smoothie bowl

Beet Blueberry Superfood Smoothie Bowl

When I find something I like, I keep it.  Here’s a great smoothie bowl that I’ve been making.  I like to add whole foods, chewable foods, to it, because there are certain body processes that are initiated by the act of chewing; our body primes our digestive system and gets signalled to release enzymes etc.  So, smoothies in moderation.

Ingredients:

scoop of frozen blueberries
some slices of cooked beets
splash of almond milk
splash of water
2 tbsp Great Lakes Gelatin, the green one (I get mine here)
Superfoods: 1tsp of each – spirulina, wheatgrass, maca powder, acai berry powder
Vanilla and Almond Extract, when I’m feeling fancy or whatever
Cinnamon and nutmeg
Himalayan Pink Sea Salt

Blended and topped with: bee pollen, cacao nibs, flax seeds, unshelled hemp hearts, banana, Manitoba Harvest Hemp pro 70 (unflavoured), and I eat it on the side with a coupla spoonfulls of nut butter, yogurt, apple and cheese.

It’s good shit.

Coming from a space where I had an eating disorder, and was a binge-purger, and had anorexia nervosa, or whatever diagnostic category is titled for an abusive relationship with food, I now look at foods based on the way my body thrives from the nutrients.  And I eat, because I love myself, unconditionally (and ongoing process).  This is important.  Food is not a “treat”, it is a beautiful accompaniment to a beautiful life.  I don’t deserve or not deserve it.  It is what it is, and I am always grateful.  I eat real food, from the earth, wholesome, no sugar/fabricated/man-made poop.

It’s a blissful way of self-respect, encompassing a symbiotic relationship between the nourishment that I am about to receive, and my mind state and body state of acceptance of the food.

Self-love is always the way, and breathe deeply.